DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1lb

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001307112.1 Gene:ppm1lb / 767640 ZFINID:ZDB-GENE-060929-136 Length:348 Species:Danio rerio


Alignment Length:290 Identity:91/290 - (31%)
Similarity:144/290 - (49%) Gaps:49/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LHTSAA----VKNKPRKMEDRCVCLDRFGEMYELLDKTTR-----FFGVFDGHSGSLSATYATSQ 214
            |.:.||    ::.:...||||          :::|..|..     .|.::|||.|..:|.||.:.
Zfish    77 LRSGAAAVYSIQGRRDHMEDR----------FDILTDTRNRSHPAIFSIYDGHGGEAAAEYAKAH 131

  Fly   215 LPQLLADQL---KANPDPAAFSPDFYRNAFESAFLLADERFTQKKIT-----SGTTSVCALITKD 271
            ||.:|..||   :...:.:|.|    |.|.....:|..:|...:|:|     :|||.:.||:::.
Zfish   132 LPIMLRQQLQRYERQKENSAVS----RQAILRQQILNMDREILEKLTASYDEAGTTCLVALLSEK 192

  Fly   272 QLYIAWVGDSKALLVGK-RTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSI 335
            :|.:|.||||:|:|..| ...:.|...|||....|||||:.|||.:..: |.|||.|:|:::||:
Zfish   193 ELTVANVGDSRAVLCDKDGNAIPLSHDHKPYQLKERKRIKKAGGFISFS-GSWRVQGVLSMSRSL 256

  Fly   336 GDY---SLEAVIAEPDFVDVQLNEAH-DFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIP 396
            ||:   .|:.:|.:||.:...|:... .|::|.:|||||.......:..:.:.|        |.|
Zfish   257 GDFPLKKLKVLIPDPDLMTFDLDTLQPQFMILASDGLWDTFSNEEAVHFIKERL--------DEP 313

  Fly   397 ----KLLIEAAKERDSQDNITAVVVLLKPR 422
                |.::..:..|...||||.:||..|.|
Zfish   314 HFGAKSIVLQSFYRGCPDNITVMVVKFKKR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 88/284 (31%)
ppm1lbNP_001307112.1 PP2Cc 82..340 CDD:238083 87/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.