DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1j

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_082258.2 Gene:Ppm1j / 71887 MGIID:1919137 Length:507 Species:Mus musculus


Alignment Length:338 Identity:73/338 - (21%)
Similarity:121/338 - (35%) Gaps:131/338 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KPRKMEDRCVCLDRFGEMYELLDKTTR------------------FFGVFDGHSGSLSATYATSQ 214
            |.|..||:..|     |:..:..:.:|                  ::|:||||:|..:|..|:..
Mouse   114 KSRHNEDQACC-----EVVYVESRRSRSVTGVSREPSHNQGFCFYYWGLFDGHAGGGAAEMASRL 173

  Fly   215 LPQLLADQLK-----------------------ANPDP-------AAFSP-------DFYRNAFE 242
            |.:.:.:|||                       ..|.|       :.:||       .....|.|
Mouse   174 LHRHIREQLKDLVEILKDPLPPPLCLPSTPGTPGAPSPSQLVSPQSCWSPQKEVTHDSLIVGAIE 238

  Fly   243 SAFLLADERFTQKK----ITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENP 303
            :||.|.||:..:::    :..|..::..|....::|:|..|||:|::|.....:.:.:...||. 
Mouse   239 NAFHLMDEQMARERRGHQVEGGCCALVVLYLLGKMYVANAGDSRAIIVRNGEIIPMSREFTPET- 302

  Fly   304 DERKRI--------ETAGGTVLHAQ----------GQ-----------W---------------- 323
             ||:|:        |..|....|.:          ||           |                
Mouse   303 -ERQRLQLLGFLKPELLGSEFTHLEFPRRVQPKELGQRMLYRDQNMTGWAYKKIEVEDLRFPLVC 366

  Fly   324 ------RVNGILNVARSIGDYSLEAVIAEPD-------FVDVQLNE-------AHDFLVLGTDGL 368
                  ||...:.|.|.:||::|:...:...       |.:|::.:       ..|.||||||||
Mouse   367 GEGKKARVMATIGVTRGLGDHNLKVCSSTLSIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGL 431

  Fly   369 WDHVPESLIIETV 381
            ||...:|.:..||
Mouse   432 WDVTNDSEVAATV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 73/338 (22%)
Ppm1jNP_082258.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
PP2Cc 105..499 CDD:238083 73/338 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..220 2/22 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.