DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ilkap

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_075832.1 Gene:Ilkap / 67444 MGIID:1914694 Length:392 Species:Mus musculus


Alignment Length:310 Identity:90/310 - (29%)
Similarity:129/310 - (41%) Gaps:65/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KNKPRKMEDRCVC-------------LDRFGEMYELLDK-----------------TTR--FFGV 198
            ||...::.::.||             .:|.||..|:.|.                 .||  :|.|
Mouse    86 KNGGEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITQECNPPSSLITRVSYFAV 150

  Fly   199 FDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPD-FYRNAFESAFLLADERFTQKKIT---- 258
            ||||.|..::.:|...|.|.|   ::..|.....|.: ..:......|...||.|.::..:    
Mouse   151 FDGHGGIRASKFAAQNLHQNL---IRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPA 212

  Fly   259 --SGTTSVCALITKDQLYIAWVGDSKALLV------GKRTQLQLVKPHKPENPDERKRIETAGGT 315
              .|:|:.|.|...:.||||.:|||:|:|.      .|...|.|.|.|.|...:||.||:.|||.
Mouse   213 WKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGN 277

  Fly   316 VLHAQGQWRVNGILNVARSIGD--YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWD-HVPE--- 374
            |...    ||.|:|.|:|||||  |....|.:.||....||.....|::|..|||:. ..||   
Mouse   278 VRDG----RVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAV 338

  Fly   375 SLIIETVYDSLADT-------TMKLDDIPKLLIEAAKERDSQDNITAVVV 417
            :.|:..:.|....|       ..:.:.....|...|.:|.|.||:|.:||
Mouse   339 NFILSCLEDDKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 90/310 (29%)
IlkapNP_075832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 2/4 (50%)
PP2Cc 108..390 CDD:238083 86/288 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.