DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ilkap

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_072128.2 Gene:Ilkap / 64538 RGDID:620128 Length:392 Species:Rattus norvegicus


Alignment Length:310 Identity:90/310 - (29%)
Similarity:129/310 - (41%) Gaps:65/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KNKPRKMEDRCVC-------------LDRFGEMYELLDK-----------------TTR--FFGV 198
            ||...::.::.||             .:|.||..|:.|.                 .||  :|.|
  Rat    86 KNGGEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITQECNPPSSLITRVSYFAV 150

  Fly   199 FDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPD-FYRNAFESAFLLADERFTQKKIT---- 258
            ||||.|..::.:|...|.|.|   ::..|.....|.: ..:......|...||.|.::..:    
  Rat   151 FDGHGGIRASKFAAQNLHQNL---IRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPA 212

  Fly   259 --SGTTSVCALITKDQLYIAWVGDSKALLV------GKRTQLQLVKPHKPENPDERKRIETAGGT 315
              .|:|:.|.|...:.||||.:|||:|:|.      .|...|.|.|.|.|...:||.||:.|||.
  Rat   213 WKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGN 277

  Fly   316 VLHAQGQWRVNGILNVARSIGD--YSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWD-HVPE--- 374
            |...    ||.|:|.|:|||||  |....|.:.||....||.....|::|..|||:. ..||   
  Rat   278 VRDG----RVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAV 338

  Fly   375 SLIIETVYDSLADT-------TMKLDDIPKLLIEAAKERDSQDNITAVVV 417
            :.|:..:.|....|       ..:.:.....|...|.:|.|.||:|.:||
  Rat   339 NFILSCLEDEKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 90/310 (29%)
IlkapNP_072128.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 2/4 (50%)
PP2Cc 108..390 CDD:238083 86/288 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.