DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1l

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_004914489.2 Gene:ppm1l / 594892 XenbaseID:XB-GENE-950664 Length:360 Species:Xenopus tropicalis


Alignment Length:265 Identity:87/265 - (32%)
Similarity:131/265 - (49%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DRFGEMYELLDKT-TRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDF------- 236
            |||..:.:|::|: ...||:||||.|..:|.|..:.||::|...|:          ||       
 Frog   107 DRFEIITDLVNKSHPSIFGIFDGHGGESAAEYVKTHLPEVLKQHLQ----------DFERDKENS 161

  Fly   237 ---YRNAFESAFLLADERFTQKKITS----GTTSVCALITKDQLYIAWVGDSKALLVGK-RTQLQ 293
               |:...|...|..|....:|...|    |||.:.||::..:|.:|.||||:.:|..| ...:.
 Frog   162 VLSYQTILEQQILAIDREMLEKLSVSYDEAGTTCLIALLSDKELTVANVGDSRGVLCDKDGNAIP 226

  Fly   294 LVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDY---SLEAVIAEPDFVDVQLN 355
            |...|||....|||||:.||| .:...|.|||.|||.::||:|||   :|..:|::||.:...|:
 Frog   227 LSHDHKPYQLKERKRIKRAGG-FISFNGSWRVQGILAMSRSLGDYPLKNLNVIISDPDILSFDLD 290

  Fly   356 EAH-DFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIP----KLLIEAAKERDSQDNITAV 415
            :.. :|::|.:|||||.......:..:.:.|        |.|    |.::..:..|...||||.:
 Frog   291 KLQPEFMILASDGLWDAFSNEEAVRFIKERL--------DEPHFGAKSIVLQSFYRGCPDNITVM 347

  Fly   416 VVLLK 420
            ||..|
 Frog   348 VVKFK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 86/262 (33%)
ppm1lXP_004914489.2 PP2Cc 93..351 CDD:238083 86/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.