DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PDP2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001316857.1 Gene:PDP2 / 57546 HGNCID:30263 Length:529 Species:Homo sapiens


Alignment Length:442 Identity:86/442 - (19%)
Similarity:150/442 - (33%) Gaps:144/442 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YDLLKLQKFVASEFEKYILKLTDN--SEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKNKPRK 171
            :.|.|..:..::|.:.:.|:|:..  :||.|..:...:................::....|.|  
Human    57 FTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSP-- 119

  Fly   172 MEDR---CVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQL-----PQLLADQLKANPD 228
            :|||   ..||...|.|          ||:||||.|...|...:.:|     ..|::.|...:.:
Human   120 VEDRRGVASCLQTNGLM----------FGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHME 174

  Fly   229 PAAFS---------------PDFYRN-------------------------AFESAFLLADERF- 252
            .|..|               ...|::                         :.|.|.:.:.:|. 
Human   175 GAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLD 239

  Fly   253 ----------TQKKIT---------SGTTSVCALITKDQLYIAWVGDSKALL-----VGKRTQLQ 293
                      .:.::|         ||.|:..|.:....|::|..||.:|:|     .|..:.|.
Human   240 SDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLP 304

  Fly   294 LVKPHKPENPDERKRI-----ETAGGTVLHAQGQWRVNGILNVARSIGD---------------- 337
            |.:.|...|..|..|:     |:...|::...   |:.|:|...|:.||                
Human   305 LTRDHNAWNQAELSRLKREHPESEDRTIIMED---RLLGVLIPCRAFGDVQLKWSKELQRSILER 366

  Fly   338 -YSLEA----------------VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSL 385
             ::.||                :.|||:....:|.....||||.:|||||.:....::..|...|
Human   367 GFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHL 431

  Fly   386 ADTTMKLDDIPK----------LLIE--AAKERDSQDNITAVVVLLKPRHQI 425
            |:......|:.:          ||::  |:...::..|....::    ||.|
Human   432 AEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLI----RHAI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 75/381 (20%)
PDP2NP_001316857.1 PP2Cc 109..517 CDD:238083 78/390 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144725
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.