DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPM1H

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_065751.1 Gene:PPM1H / 57460 HGNCID:18583 Length:514 Species:Homo sapiens


Alignment Length:423 Identity:81/423 - (19%)
Similarity:140/423 - (33%) Gaps:155/423 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DEAAPENCECHQQKEPLHTSAAVKNKP-RKMEDRCVCLDRFGEMYELLDK------TTRFFGVFD 200
            |:|   :||....|:   .:.||.:.| |....|...|.. ||..:|.:.      :..::.:||
Human    94 DQA---SCEVLTVKK---KAGAVTSTPNRNSSKRRSSLPN-GEGLQLKENSESEGVSCHYWSLFD 151

  Fly   201 GHSGSLSATYATSQLPQLLADQLK----------------------------------------- 224
            ||:||.:|..|:..|...:.:||:                                         
Human   152 GHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAASLRGGV 216

  Fly   225 -ANPDPAAFSPDFYR-----------NAFESAFLLADERFTQKK----ITSGTTSVCALITKDQL 273
             |...|:.....|:.           .|.||||...|.:..:::    |:.|.|::..:....:|
Human   217 GAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGKL 281

  Fly   274 YIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQ---------------- 322
            |:|..|||:|:::.....:.:.....||.  ||:|::.......|..|.                
Human   282 YVANAGDSRAIIIRNGEIIPMSSEFTPET--ERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKEL 344

  Fly   323 -------------W----------------------RVNGILNVARSIGDYSLEA---------- 342
                         |                      ||...:.|.|.:||:.|:.          
Human   345 GKKMLYRDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPF 409

  Fly   343 VIAEPDFVDVQLNE----AHDFLVLGTDGLWDHVPESLIIETVYDSLADT--------TMKLDDI 395
            :.:.|:.....|::    :.|.|:|.||||||.:....:.|.:...|.:.        |:...|:
Human   410 LSSAPEVRIYDLSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDL 474

  Fly   396 PKLLIEAAKER---------DSQDNITAVVVLL 419
            ........|:|         .|.|:|:..|:.|
Human   475 VMRARGVLKDRGWRISNDRLGSGDDISVYVIPL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 75/404 (19%)
PPM1HNP_065751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..135 9/26 (35%)
PP2Cc 143..507 CDD:238083 66/365 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.