DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1nb

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001096587.1 Gene:ppm1nb / 564875 ZFINID:ZDB-GENE-071004-34 Length:435 Species:Danio rerio


Alignment Length:281 Identity:87/281 - (30%)
Similarity:127/281 - (45%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 MEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQ--LLADQLKANPDPAAFSP 234
            |||...|..:.|.  ||  ....||.|||||:||..|...:..|..  |...:::|:.|....: 
Zfish    91 MEDFHNCFPQLGG--EL--SHWAFFAVFDGHAGSAVAQNCSRNLLDHILGTGKIRADEDVERVT- 150

  Fly   235 DFYRNAFESAFLLADERFTQKKI-----TSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQL 294
                ..|:..|.|.|:.......     ..|||.|...||...:|....|||:|:|.........
Zfish   151 ----EGFKEGFFLMDKHLHAMACREGWERGGTTVVSTAITPHHIYFVNCGDSRAVLCRAGRVAFS 211

  Fly   295 VKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL----------EAVIAEPDF 349
            .:.|||.:|.|::|||:|||:|.    ..||||.|.|:|::||:|.          :.|..||:.
Zfish   212 TEDHKPFSPGEKERIESAGGSVT----LQRVNGSLAVSRALGDFSYKTVEWRSVTEQMVSPEPEV 272

  Fly   350 VDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITA 414
            ..|:.:.|.:||||..||:||.|....:...|:..|...| .|.::...:|:....:.|.|||:.
Zfish   273 SVVERSPADEFLVLACDGVWDTVSNEELCAFVHSRLRICT-DLREVCSQVIDLCLYKGSLDNISI 336

  Fly   415 VVVL------LKP---RHQIE 426
            ::|.      |.|   .|:.|
Zfish   337 ILVCFPGAPQLSPEALHHEAE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 83/269 (31%)
ppm1nbNP_001096587.1 PP2Cc 79..341 CDD:238083 83/263 (32%)
PP2C_C 335..412 CDD:285117 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577908
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.