Sequence 1: | NP_609899.1 | Gene: | CG10376 / 35126 | FlyBaseID: | FBgn0032702 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009303413.1 | Gene: | pptc7b / 562909 | ZFINID: | ZDB-GENE-081105-111 | Length: | 297 | Species: | Danio rerio |
Alignment Length: | 284 | Identity: | 58/284 - (20%) |
---|---|---|---|
Similarity: | 91/284 - (32%) | Gaps: | 115/284 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 KTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFT-- 253
Fly 254 --------------QKKI-TSGTTSVCALI---TKDQLYIAWVGDSKALLVGKRTQLQLVKPHKP 300
Fly 301 ENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVI-------AEPDFVDVQLNEAH 358
Fly 359 DFLVLGTDGLWDHVPESLIIE-------TVYDSLADTTM-------------------------- 390
Fly 391 -------KLDDIPKLLIEAAKERD 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10376 | NP_609899.1 | PP2Cc | 160..419 | CDD:238083 | 58/284 (20%) |
pptc7b | XP_009303413.1 | PP2Cc | 53..289 | CDD:294085 | 54/274 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |