DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and pptc7b

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_009303413.1 Gene:pptc7b / 562909 ZFINID:ZDB-GENE-081105-111 Length:297 Species:Danio rerio


Alignment Length:284 Identity:58/284 - (20%)
Similarity:91/284 - (32%) Gaps:115/284 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 KTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFT-- 253
            |:....||.||..|  ...|..               ||:.||....:....   |:.:.|||  
Zfish    62 KSADVLGVADGVGG--WRDYGV---------------DPSQFSATLMKTCER---LVKEGRFTPS 106

  Fly   254 --------------QKKI-TSGTTSVCALI---TKDQLYIAWVGDSKALLVGKRTQLQLVKPHKP 300
                          |.|: ..|:::.|.::   ...:::...:|||..|:|              
Zfish   107 SPVGILTSGYYELLQNKVPLLGSSTACIVVLDRRSHRIHTCNLGDSGFLVV-------------- 157

  Fly   301 ENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVI-------AEPDFVDVQLNEAH 358
                       .||.|:|...:.:.........||.....|.|:       |:....||||.   
Zfish   158 -----------RGGEVVHRSDEQQHYFNTPFQLSIAPPGAEGVVLSDSPEAADSSSFDVQLG--- 208

  Fly   359 DFLVLGTDGLWDHVPESLIIE-------TVYDSLADTTM-------------------------- 390
            |.::..||||:|::|:.:|::       |.|||:..|..                          
Zfish   209 DIILTATDGLFDNMPDYMILQELKKLKNTNYDSIQQTARSIAEQAHELAYDPNYMSPFAQFACDN 273

  Fly   391 -------KLDDIPKLLIEAAKERD 407
                   |.|||..||...|:.:|
Zfish   274 GLNVRGGKPDDITVLLSIVAEYKD 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 58/284 (20%)
pptc7bXP_009303413.1 PP2Cc 53..289 CDD:294085 54/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.