DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1ka

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_009295416.1 Gene:ppm1ka / 562087 ZFINID:ZDB-GENE-110411-37 Length:370 Species:Danio rerio


Alignment Length:262 Identity:89/262 - (33%)
Similarity:131/262 - (50%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSP 234
            |:.|:.    ||| ::.| |.:...:|.:||||.|:.:|.|....:.|.:.|.|:...|      
Zfish   101 RRRENE----DRF-QVSE-LTQNVLYFALFDGHGGAHAADYCHKHMEQNIRDCLEMETD------ 153

  Fly   235 DFYRNAFESAFLLADERFTQK--------KITSGTTSVCALITKD--QLYIAWVGDSKALLVGKR 289
              .:.....|||..|....:|        .:..|||:..||: :|  :|.:..||||:|||..|.
Zfish   154 --LQTVLSKAFLEVDAALEEKLQIYGNASLMMVGTTATVALL-RDGIELVVGSVGDSRALLCRKG 215

  Fly   290 TQLQLVKPHKPENPDERKRIETAGGTVL-HAQGQWRVNGILNVARSIGDYSLE--AVIAEPDFVD 351
            ...:|...|.||..||:.||..:||.|. ::.||..|||.|.:.|||||:.|:  .|||||:...
Zfish   216 KSRKLTDDHTPERKDEKHRIRQSGGFVTWNSVGQANVNGRLAMTRSIGDFDLKKSGVIAEPEITR 280

  Fly   352 VQLNEAHD-FLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAV 415
            ..|..||| ||||.|||: :.:..:..|..:.:...|.|    :...::.|.|.:..|:||.|.:
Zfish   281 TLLQHAHDSFLVLTTDGV-NFIMSNQEICDIINLCHDPT----EAANVIAEQALQYGSEDNSTVI 340

  Fly   416 VV 417
            ||
Zfish   341 VV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 89/262 (34%)
ppm1kaXP_009295416.1 PP2Cc 92..344 CDD:238083 89/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.