DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1j

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_684981.2 Gene:ppm1j / 556950 ZFINID:ZDB-GENE-091230-9 Length:496 Species:Danio rerio


Alignment Length:392 Identity:83/392 - (21%)
Similarity:137/392 - (34%) Gaps:151/392 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RKM---EDRC-VCLDRFGEMYELLDKTT----RFFGVFDGHSGSLSATYATSQLPQLLADQL--- 223
            |||   :.|| :.|:..|:       ||    .|:||||||:||.:|..|:..|.:::.|:|   
Zfish   107 RKMSSKQQRCSMLLEESGD-------TTGIPMHFWGVFDGHAGSGAALMASKLLQRIIRDRLCDV 164

  Fly   224 ------KANPDPAAFS----------------------------PDFY-----------RNAFES 243
                  ..:|.|...:                            |.|:           ....|:
Zfish   165 AHLLENHNSPPPICLAKNGSPFQAEGKKGACLDGEEQDAGLPDEPRFHMEKDISVESLVMGIIET 229

  Fly   244 AFLLADERFTQKK----ITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPD 304
            ||...|:...::|    |:.|..::.|:....:||:|..|||:|::|.....:.:.....||:  
Zfish   230 AFRQMDDLIEKEKESYSISGGCCALVAIHLMGKLYVANAGDSRAIIVRNSEVIPMSTEFTPES-- 292

  Fly   305 ERKRIETAG-------------------------GTVL----HAQGQW----------------- 323
            ||:|::..|                         |..:    |....|                 
Zfish   293 ERQRLQYLGFLKPELLGNEFTHIEFPRRIQHKELGKKMLFRDHTMTGWAYKTIIEDDLKFPLIYG 357

  Fly   324 -----RVNGILNVARSIGDYSLEAVIAE----------PDFVDVQLNE----AHDFLVLGTDGLW 369
                 ||...:.|.|.:||:.|:...:.          |:.....::|    :.|.||:|:||||
Zfish   358 EGKKARVMATIGVTRGLGDHDLKVYNSNIYIKPFLSCCPEVKVYNISEHKHGSDDVLVMGSDGLW 422

  Fly   370 DHVPESLIIETVYDSLADT--------TMKLDDIPKLLIEAAKER---------DSQDNITAVVV 417
            |...:..:.:.|...|:..        |:...|:........|||         .|.|:||..|:
Zfish   423 DVTADRDVADAVSTFLSSREPNDPLRYTLAAQDLLMRSRGVLKERGWRLPNERLGSGDDITVFVI 487

  Fly   418 LL 419
            .|
Zfish   488 PL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 82/390 (21%)
ppm1jXP_684981.2 PP2Cc 130..489 CDD:238083 73/360 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.