DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPM1A

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_016876870.1 Gene:PPM1A / 5494 HGNCID:9275 Length:459 Species:Homo sapiens


Alignment Length:247 Identity:78/247 - (31%)
Similarity:123/247 - (49%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FFGVFDGHSGSLSATYATSQLPQLLADQLKANPD----PAAFSPDFYRNAFESAFLLADER---F 252
            ||.|:|||:||..|.|....    |.|.:..|.|    ..|.|.:..:|...:.||..||.   .
Human   132 FFAVYDGHAGSQVAKYCCEH----LLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVM 192

  Fly   253 TQKK---ITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGG 314
            ::||   ..||:|:|..||:....|....|||:.||...|......:.|||.||.|::||:.|||
Human   193 SEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG 257

  Fly   315 TVLHAQGQWRVNGILNVARSIGDYSL----------EAVIAEPDFVDVQLNEAHD-FLVLGTDGL 368
            :|:..    ||||.|.|:|::||:..          :.|..||:..|::.:|..| |::|..||:
Human   258 SVMIQ----RVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGI 318

  Fly   369 WDHVPESLIIETVYDSLADTTMKLDDIPKL---LIEAAKERDSQDNITAVVV 417
            ||.:....:.:.|...|..|    ||:.|:   :::....:.|:||::.:::
Human   319 WDVMGNEELCDFVRSRLEVT----DDLEKVCNEVVDTCLYKGSRDNMSVILI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 78/247 (32%)
PPM1AXP_016876870.1 PP2Cc 100..368 CDD:238083 78/247 (32%)
PP2C_C 362..437 CDD:285117 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144726
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.