DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1kb

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001314673.1 Gene:ppm1kb / 503713 ZFINID:ZDB-GENE-050306-8 Length:372 Species:Danio rerio


Alignment Length:274 Identity:85/274 - (31%)
Similarity:137/274 - (50%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKAN 226
            ||:...:.::.|||.       :|.::.| ...:|.|||||.|:.:|.:....:.:.:.| :.|.
Zfish    97 SASQIGQRKENEDRY-------QMSQMTD-NIMYFAVFDGHGGAEAADFCHKNMEKHIKD-IAAE 152

  Fly   227 PDPAAFSPDFYRNAFESAFLLADERFTQ--------KKITSGTTSVCALITKD--QLYIAWVGDS 281
            .....|       ....|||..|:...:        ..:::|||:..||: :|  :|.:..||||
Zfish   153 ETNLEF-------VLTKAFLEVDKALARHLHFSADASVLSAGTTATVALL-RDGIELVVGSVGDS 209

  Fly   282 KALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVL-HAQGQWRVNGILNVARSIGDYSLEA--V 343
            :|::..|...::|...|.||..||::||..:||.:. ::.||..|||.|.:.|||||:.|:|  |
Zfish   210 RAMMCRKGKAVKLTVDHTPERKDEKERIRRSGGFITWNSLGQPHVNGRLAMTRSIGDFDLKATGV 274

  Fly   344 IAEPDFVDVQLNEAHD-FLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPK----LLIEAA 403
            ||||:...:.|:..|| ||.|.|||:      :.|:.:  ..:.|...:..| ||    .:.|.|
Zfish   275 IAEPETKRISLHHVHDSFLALTTDGI------NFIMNS--QEICDVINQCHD-PKEAAQRISEQA 330

  Fly   404 KERDSQDNITAVVV 417
            .:..|:||.|.:||
Zfish   331 LQYGSEDNSTIIVV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 85/274 (31%)
ppm1kbNP_001314673.1 PP2Cc 94..346 CDD:238083 85/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.