DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1b

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_012818372.1 Gene:ppm1b / 493392 XenbaseID:XB-GENE-999170 Length:455 Species:Xenopus tropicalis


Alignment Length:287 Identity:84/287 - (29%)
Similarity:136/287 - (47%) Gaps:52/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219
            :.|..||  ||...||.::|                  ..||.|:|||:||..|.|.:|.|.:.:
 Frog    35 EMEDAHT--AVVGIPRGLDD------------------WSFFAVYDGHAGSRVANYCSSHLLEHI 79

  Fly   220 AD--QLKANPDP-AAFSP--DFYRNAFESAFLLADE---RFTQKK---ITSGTTSVCALITKDQL 273
            .|  ..:|...| :|..|  :..::...:.||..||   .|...:   ..||:|:|..|::...:
 Frog    80 TDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHV 144

  Fly   274 YIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDY 338
            |....|||:|:|..........:.|||.||.|::||:.|||:|:..    ||||.|.|:|::|||
 Frog   145 YFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQ----RVNGSLAVSRALGDY 205

  Fly   339 SL----------EAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLD 393
            ..          :.|..||:..::...:..:|::|..||:||.:....:.|.|...|..|    |
 Frog   206 DYKCVDGKGPTEQLVSPEPEVYEIVRADEDEFIILACDGIWDVMSNEELCEFVKYRLELT----D 266

  Fly   394 DIPKL---LIEAAKERDSQDNITAVVV 417
            |:.|:   :::....:.|:||::.|:|
 Frog   267 DLEKVCNSVVDTCLHKGSRDNMSIVLV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 83/282 (29%)
ppm1bXP_012818372.1 PP2Cc 23..295 CDD:238083 84/287 (29%)
PP2C_C 289..365 CDD:369544 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.