DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and pptc7a

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001007379.1 Gene:pptc7a / 492506 ZFINID:ZDB-GENE-041114-74 Length:297 Species:Danio rerio


Alignment Length:199 Identity:44/199 - (22%)
Similarity:72/199 - (36%) Gaps:65/199 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 DPAAFSPDFYRNAFESAFLLADERFT----------------QKKI-TSGTTSVCALITKDQ--- 272
            ||:.||....|....   |:.:.||.                |.|: ..|:::.|.::...|   
Zfish    82 DPSQFSGTLMRTCER---LVKEGRFVPSNPVGILTTSYYELLQNKVPLLGSSTACIVVLDRQSHR 143

  Fly   273 LYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD 337
            |:.|.:|||..|:|                         .||.|:|...:.:.........||..
Zfish   144 LHTANLGDSGFLVV-------------------------RGGEVVHRSDEQQHYFNTPFQLSIAP 183

  Fly   338 YSLEAVI-------AEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIE-------TVYDSLADT 388
            ...|..:       |:....||||.   |.::..||||:|::|:.:|::       |.|:|...|
Zfish   184 PEAEGSVLSDSPDAADSSSFDVQLG---DIILTATDGLFDNMPDYMILQELKKLKNTNYESTQQT 245

  Fly   389 TMKL 392
            ...:
Zfish   246 AKSI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 44/199 (22%)
pptc7aNP_001007379.1 PP2Cc 53..289 CDD:381813 44/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.