DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and drg2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001006840.1 Gene:drg2 / 448585 XenbaseID:XB-GENE-5910548 Length:364 Species:Xenopus tropicalis


Alignment Length:107 Identity:25/107 - (23%)
Similarity:39/107 - (36%) Gaps:26/107 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EKAAAVSEEVVSRSCVTRTANETYKVSGEERHAELVSAIWKQLETRGCPAQFRIKLLHRSTQQLE 90
            ||.:.:..|:.          .|.|....|.|..|:.|   :|      |::|.:||..|.....
 Frog     5 EKISEIEREIA----------RTQKNKATEYHLGLLKA---KL------AKYRAQLLEPSKSAAN 50

  Fly    91 Q----DLCFAKECEVTVEGPP---QYDLLKLQKFVASEFEKY 125
            :    |:..:.:..|.:.|.|   :...|.|....|||...|
 Frog    51 KGEGFDVMKSGDARVALIGFPSVGKSTFLSLMTSTASEAASY 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083
drg2NP_001006840.1 Rbg1 1..364 CDD:224085 25/107 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.