DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and fig

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_651724.1 Gene:fig / 43511 FlyBaseID:FBgn0039694 Length:314 Species:Drosophila melanogaster


Alignment Length:293 Identity:62/293 - (21%)
Similarity:103/293 - (35%) Gaps:87/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KPRKMEDRCVCLDRFGEMYELLDKT--TRFFGVFDGHSG----SLSATYATSQLPQLLADQLKAN 226
            |||...:|  ...||||....:..|  ....||.||..|    .:.|.....:|....:.|.:.:
  Fly    55 KPRFPGER--SNQRFGEDSWFVSSTPLAEVMGVADGVGGWRDLGVDAGRFAKELMSCCSGQTQLS 117

  Fly   227 PDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKD-QLYIAWVGDSKALLVGKRT 290
             |....||   ||...:.|.....| ....:.|.|..:..:..|| .||.|.:|||..|:|    
  Fly   118 -DFDGRSP---RNMLIAGFQELSHR-EHPVVGSSTACLATMHRKDCTLYTANLGDSGFLVV---- 173

  Fly   291 QLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSI---GDYSLEAVIAEP----- 347
                                 ..|.|||              ||:   .|::....:..|     
  Fly   174 ---------------------RNGRVLH--------------RSVEQTHDFNTPYQLTVPPEDRK 203

  Fly   348 -----DFVDVQLNEAH-----DFLVLGTDGLWDHVPESLIIETV--------YDSLADTTMKLDD 394
                 |..::.::..|     |.::|.||||:|::|||:::..:        :|.|...:.    
  Fly   204 ESYYCDKPEMAVSTRHSLLPGDLVLLATDGLFDNMPESMLLSILNGLKERGEHDLLVGASR---- 264

  Fly   395 IPKLLIEAAKERDSQDNITAVVVLLKPRHQIEH 427
                ::|.|:|.....:..:...:...:|.:.:
  Fly   265 ----VVEKARELSMNASFQSPFAIKARQHNVSY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 61/283 (22%)
figNP_651724.1 PP2Cc 68..306 CDD:294085 56/278 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.