DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1na

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_998046.1 Gene:ppm1na / 405817 ZFINID:ZDB-GENE-040426-2731 Length:424 Species:Danio rerio


Alignment Length:335 Identity:78/335 - (23%)
Similarity:145/335 - (43%) Gaps:52/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VASEFEKYIL------KLTDNSEVDRLKDFADEAAP---------ENCECHQQKEPLHTSAAVKN 167
            :..|.||.:.      :....|:.|..::..|..:|         ::.|...:....:..|:::.
Zfish    10 LVKETEKMVTFFFKGGRRDSGSDDDYYENDPDACSPYLERPILAKDSAEGESKWGITYAMASMQG 74

  Fly   168 KPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQ--LKANPDPA 230
            ...:|||...|:.   ||.:.|...: :|.|:|||:|...|.|::..|...:.|.  :....|  
Zfish    75 WRAQMEDSHTCMP---EMSDALPDWS-YFAVYDGHAGRTVAQYSSRHLLDFILDTGCVTVEED-- 133

  Fly   231 AFSPDFYRNAFESAFLLADERF-----TQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRT 290
               .:..::.....||..|...     .:....||:|:...:|:....|....|||:..|.....
Zfish   134 ---VEQVKDGIREGFLAIDRHMHTLSRNESWDHSGSTAASVMISPRNFYFINCGDSRTFLCRDGH 195

  Fly   291 QLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL----------EAVIA 345
            .:...:.|||.||.|::||:.|||:|.    ..|:||.|.|:|::||:..          :.|..
Zfish   196 VVFYTEDHKPCNPREKERIQNAGGSVT----LQRINGSLAVSRALGDFDFKEVEWRAQTEQLVSP 256

  Fly   346 EPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKL---LIEAAKERD 407
            ||:..:::.:...:|||:..||:||.:....:...|.:.|    ...||:.::   :|:....:.
Zfish   257 EPEVYELERSPEDEFLVVACDGVWDAIGNEDLCAFVRNRL----HVCDDLREICSQVIDLCLYKG 317

  Fly   408 SQDNITAVVV 417
            |.||:|.:::
Zfish   318 SLDNMTIIII 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 70/278 (25%)
ppm1naNP_998046.1 PP2Cc 67..329 CDD:238083 70/278 (25%)
PP2C_C 323..400 CDD:285117 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.