DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1da

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_957384.2 Gene:ppm1da / 394065 ZFINID:ZDB-GENE-040426-815 Length:535 Species:Danio rerio


Alignment Length:316 Identity:83/316 - (26%)
Similarity:135/316 - (42%) Gaps:87/316 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QQKEPLHT--SAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLP 216
            |..||:.|  .|::.:.......|.|.|                |.|||||.|..:|.:|...  
Zfish    73 QDDEPISTLQHASMPSSVHARRPRAVAL----------------FAVFDGHGGPDAARFARDH-- 119

  Fly   217 QLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQK-----------KITSGTTSVCALITK 270
              |.|.:|......:...|....|....|:.......:|           ..|||||:...::.:
Zfish   120 --LWDHIKKQRGFWSEDDDEVCAALRKGFITCHHAMWKKLPEWPKTVTGLPSTSGTTASIVVLRR 182

  Fly   271 DQLYIAWVGDSKALLVGKRTQ--------LQLVKPHKPENPDERKRIETAGGTVLHAQGQWRV-- 325
            |::|:|.|||| |:::|.:..        :::.:.|||:.|.||:|||..||:|:...|..||  
Zfish   183 DRMYVAHVGDS-AVVLGVQDHPSEEFIRAVEITQDHKPDLPKERERIEGLGGSVIKKSGVNRVVW 246

  Fly   326 -------NG------------ILNVARSIGD------YSLEAVIA-EPDFVDVQLN-EAHDFLVL 363
                   ||            .|.|||::||      ||.|.|:: |||...::|: :.|.:::|
Zfish   247 KRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFYSGEFVVSPEPDTAVIKLDLKQHRYIIL 311

  Fly   364 GTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVVLL 419
            |:||||:.|.....:....|:                :.||.::.:.|::..|:|:
Zfish   312 GSDGLWNMVSPQEAVSICQDN----------------DEAKAKNQKGNVSNAVLLV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 79/308 (26%)
ppm1daNP_957384.2 PP2Cc 98..375 CDD:238083 77/291 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.