DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pdp2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001019777.1 Gene:Pdp2 / 382051 MGIID:1918878 Length:532 Species:Mus musculus


Alignment Length:465 Identity:89/465 - (19%)
Similarity:141/465 - (30%) Gaps:184/465 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PPQYDLLKLQKFVASEFEKYILKLTDNSEVDRLK---------DFADEAAPENC---ECHQQKEP 158
            |..:.|.|..:..::|.|.:.|:|:.....|.|:         || :...|.:.   |.:|    
Mouse    57 PGGFALRKAYRHTSTEEEDFHLQLSPEQVSDLLRAGESSHKVLDF-NNGVPNSVLRFESNQ---- 116

  Fly   159 LHTSAAVKNKPRKMEDR---CVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQL----- 215
                 ...|.|  :|||   ..|:...|.|          ||:||||.|...|...:.:|     
Mouse   117 -----LAANSP--VEDRQGVATCVQTNGMM----------FGIFDGHGGHACAQAVSERLFYYMA 164

  Fly   216 -----PQLLADQLKANPDPAAFSP----------DFYRN-------------------------A 240
                 .|.|....:|..:.....|          ..|::                         :
Mouse   165 VSLMSHQTLEQMEEATENMKPLLPILRWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLS 229

  Fly   241 FESAFLLADERF-----------TQKKIT---------SGTTSVCALITKDQLYIAWVGDSKALL 285
            .|.|.:.:.:|.           .:.::|         ||.|:..|.:....|::|..||.:|:|
Mouse   230 IEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVNGVHLHVANAGDCRAIL 294

  Fly   286 -------------------VGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNV 331
                               .....:|..:|...||:.|....|:.            |:.|:|..
Mouse   295 GVQEENGAWSCLPLTCDHNAWNEAELSRLKREHPESEDRTLIIDD------------RLLGVLMP 347

  Fly   332 ARSIGDYSL-----------------EA----------------VIAEPDFVDVQLNEAHDFLVL 363
            .|:.||..|                 ||                :.|:|:....:|.....||||
Mouse   348 CRAFGDVQLKWSKELQRNVLARGFDTEALNIYQFTPPHYYTPPYLTAKPEVTYHRLRRQDKFLVL 412

  Fly   364 GTDGLWDHVPESLIIETVYDSLADTTMKLDDIPK-----------LLIEAAKERDSQDNITAVVV 417
            .:|||||.:....::..|...|:.......|:.:           ||...|....:.|..||.  
Mouse   413 ASDGLWDMLGNEDVVRLVVGHLSKVGRHKPDLDQRPANLGLMQSLLLQRKASGLHAADQNTAT-- 475

  Fly   418 LLKPRHQIEH 427
                 |.|.|
Mouse   476 -----HLIRH 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 72/389 (19%)
Pdp2NP_001019777.1 PP2Cc 112..520 CDD:238083 77/409 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.