DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and CG12091

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster


Alignment Length:247 Identity:54/247 - (21%)
Similarity:91/247 - (36%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KNKPRKMEDRCVCLDRFGE--MYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPD 228
            |.||.|          :||  .::....:....||.||..|..|......:....|....:....
  Fly    71 KYKPGK----------YGEDSWFKASTASADVMGVADGVGGWRSYGIDPGEFSSFLMRTCERLVQ 125

  Fly   229 PAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALITKDQ---LYIAWVGDSKALLVGKRT 290
            .:.|:|....|....::.   |...|||...|:::.|.||...:   ::.|.:|||..::|   .
  Fly   126 CSHFNPQRPVNLLAYSYC---ELMEQKKPILGSSTACVLILNRETSTVHTANIGDSGFVVV---R 184

  Fly   291 QLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVIAEPDFVDVQLN 355
            :.|:|  ||.|  :::....|.....|...|.             |...|.......|.:...:.
  Fly   185 EGQVV--HKSE--EQQHYFNTPFQLSLPPPGH-------------GPNVLSDSPESADTMSFPVR 232

  Fly   356 EAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERD 407
            :. |.:::.|||::|:|||.|:::                  :|.|...|||
  Fly   233 DG-DVILIATDGVFDNVPEDLMLQ------------------VLSEVEGERD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 54/247 (22%)
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 51/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.