DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pdp1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001277316.1 Gene:Pdp1 / 381511 MGIID:2685870 Length:578 Species:Mus musculus


Alignment Length:394 Identity:83/394 - (21%)
Similarity:122/394 - (30%) Gaps:152/394 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PPQYD-LLKLQK--FVASEFEKYILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKN 167
            |||.: :||..:  |...||        |...|..:..|.....|.|.                 
Mouse   122 PPQVNSILKANEYSFKVPEF--------DGKNVSSILGFDSNQLPANA----------------- 161

  Fly   168 KPRKMEDR---CVCLDRFGEMYELLDKTTRFFGVFDGHSG---------SLSATYATSQLP-QLL 219
               .:|||   ..||...|.:          .||||||:|         .|....|.|.|| :.|
Mouse   162 ---PIEDRRSAATCLQTRGML----------LGVFDGHAGCACSQAVSERLFYYIAVSLLPHETL 213

  Fly   220 ADQLKANPDPAAFSP---------DFYR---------------------NAFESAFLLADERFTQ 254
            .:...|.....|..|         |::.                     |..|||.:...|....
Mouse   214 LEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESADIDVKEALIN 278

  Fly   255 --KKIT-------------------------SGTTSVCALITKDQLYIAWVGDSKALL-----VG 287
              |::.                         ||.|:..|.:....|::|..|||:|:|     .|
Mouse   279 AFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQEEDG 343

  Fly   288 KRTQLQLVKPHKPENPD--ERKRIETAGGTVLHAQGQWRVNGILNVARSIGD----YSLEA---- 342
            ..:.:.|...|..:|..  ||.::|...........|.|:.|:|...|:.||    :|::.    
Mouse   344 SWSAVTLSNDHNAQNERELERLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGDVKFKWSIDLQKRV 408

  Fly   343 --------------------------VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV 381
                                      :.|||:....:|.....||||.|||||:.:....::..|
Mouse   409 IESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGLWETMHRQDVVRIV 473

  Fly   382 YDSL 385
            .:.|
Mouse   474 GEYL 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 70/337 (21%)
Pdp1NP_001277316.1 PP2Cc 149..565 CDD:238083 73/359 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834837
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.