DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT2G05050

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001154495.1 Gene:AT2G05050 / 3767735 AraportID:AT2G05050 Length:193 Species:Arabidopsis thaliana


Alignment Length:259 Identity:58/259 - (22%)
Similarity:96/259 - (37%) Gaps:89/259 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DRFGEMYELL-DKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFES 243
            |||..:..|. |:....|||:.||.|..:|.:|...|.:.:.::                     
plant     3 DRFSTITNLHGDRKQAIFGVYVGHGGVKAAEFAAKNLDKNIVEE--------------------- 46

  Fly   244 AFLLADERFTQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERK- 307
                                                     :||||.:|::.        :..| 
plant    47 -----------------------------------------VVGKRHELEIA--------EALKF 62

  Fly   308 ------RIETAGGTVLHAQGQ-------WRVNGILNVARSIGDYSLEA-VIAEPDFVDVQLNEAH 358
                  |:|...|..|..:..       ||:.|.|.|.|.|||..|:. |||||:....::...|
plant    63 YFLIIVRLEMMNGKELKPREDMLIRFTLWRIQGSLVVPRGIGDAQLKKWVIAEPETKISRVEHDH 127

  Fly   359 DFLVLGTDGLWDHV--PESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVVLLK 420
            :||:|.:.||||.|  .|::.|...:....:..:.|....| |::.:..|.|.|:|:.:::.|:
plant   128 EFLILASHGLWDKVSNQEAVDIARPFCLRTEKPLLLAACKK-LVDLSASRGSFDDISVMLIPLR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 57/256 (22%)
AT2G05050NP_001154495.1 PP2Cc 1..189 CDD:238083 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.