DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPM1J

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_005158.5 Gene:PPM1J / 333926 HGNCID:20785 Length:505 Species:Homo sapiens


Alignment Length:331 Identity:73/331 - (22%)
Similarity:120/331 - (36%) Gaps:119/331 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KPRKMEDRCVCLDRFGEMYELLDKTTR-----------FFGVFDGHSGSLSATYATSQLPQLLAD 221
            |.|..||:..|...:.|....:....|           ::|:||||:|..:|..|:..|.:.:.:
Human   115 KSRHNEDQACCEVVYVEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGGGAAEMASRLLHRHIRE 179

  Fly   222 QLK--------ANPDPAAF-----SPD------------------------FYRNAFESAFLLAD 249
            |||        .:|.|...     :||                        ....|.|:||.|.|
Human   180 QLKDLVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEVSHESLVVGAVENAFQLMD 244

  Fly   250 ERFTQKK----ITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRI- 309
            |:..:::    :..|..::..:....::|:|..|||:|::|.....:.:.:...||.  ||:|: 
Human   245 EQMARERRGHQVEGGCCALVVIYLLGKVYVANAGDSRAIIVRNGEIIPMSREFTPET--ERQRLQ 307

  Fly   310 -------ETAGGTVLHAQ----------GQ-----------W----------------------R 324
                   |..|....|.:          ||           |                      |
Human   308 LLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKAR 372

  Fly   325 VNGILNVARSIGDYSLEAVIA----EP---DFVDVQLNE-------AHDFLVLGTDGLWDHVPES 375
            |...:.|.|.:||:||:...:    :|   .|.:|::.:       ..|.||||||||||...:.
Human   373 VMATIGVTRGLGDHSLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDC 437

  Fly   376 LIIETV 381
            .:..||
Human   438 EVAATV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 73/331 (22%)
PPM1JNP_005158.5 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103
PP2Cc 106..498 CDD:238083 73/331 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.