DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pptc7

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_796216.2 Gene:Pptc7 / 320717 MGIID:2444593 Length:310 Species:Mus musculus


Alignment Length:191 Identity:45/191 - (23%)
Similarity:72/191 - (37%) Gaps:49/191 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 DPAAFSPDFYRNAFESAFLLADERFT-QKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQ 291
            ||:.||....|....   |:.:.||. ...:...|||.|.|:           .:|..|:|..|.
Mouse    95 DPSQFSGTLMRTCER---LVKEGRFVPSNPVGILTTSYCELL-----------QNKVPLLGSSTA 145

  Fly   292 LQLVKPHKPENPDERKRIETA-----------GGTVLHAQGQWRVNGILNVARSIGDYSLEAVI- 344
            ..:|......      |:.||           ||.|:|...:.:.........||.....|.|: 
Mouse   146 CIVVLDRSSH------RLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVL 204

  Fly   345 ------AEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV-------YDSLADTTMKL 392
                  |:....||||.   |.::..||||:|::|:.:|::.:       |:|:..|...:
Mouse   205 SDSPDAADSTSFDVQLG---DIILTATDGLFDNMPDYMILQELKKLKNSNYESIQRTARSI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 45/191 (24%)
Pptc7NP_796216.2 PP2Cc 66..302 CDD:381813 45/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.