DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pdp

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster


Alignment Length:336 Identity:82/336 - (24%)
Similarity:124/336 - (36%) Gaps:116/336 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GVFDGHSGS---------LSATYATSQLP-QLLADQLKANPDPAAF------SPDF-------YR 238
            |:||||:|:         |....:.:.|| |:|.:|:|...|..:|      :.||       |.
  Fly    90 GIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYE 154

  Fly   239 NAF-------------------ESAFLLADERFTQKKIT-----------SGTTSVCALITKDQL 273
            .:|                   .:|||..||..:|:.:|           ||..:....|...|:
  Fly   155 ASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGLQM 219

  Fly   274 YIAWVGDSKALL--VGKRTQ----LQLVKPHKPENPDERKRI---------ETA--GGTV----- 316
            ::|..||..|:|  :..:||    .:|...|..:|..|.:||         ||.  .|.:     
  Fly   220 HVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQLA 284

  Fly   317 -LHAQGQWRVN--------------GILNVARSIGDYSLEAVIAEPDFVDVQLNEAHDFLVLGTD 366
             |.|.|.:|..              |:..:|.:.  |:...:.|.||....:|.....|||:.:|
  Fly   285 PLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNY--YTPPYLTARPDVQQHELGPNDKFLVIASD 347

  Fly   367 GLWDHVPESLIIETVYDSL-------------ADTTMKLDDIPKLLIE--AAKERDSQDNITAVV 416
            ||||.:|.|.::..|.:.:             .|||  |.:|.:.|.|  |...|...|...|. 
  Fly   348 GLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTT--LQEISQQLAERKAGLTRKPVDQNAAT- 409

  Fly   417 VLLKPRHQIEH 427
                  |.|.|
  Fly   410 ------HLIRH 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 79/326 (24%)
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 74/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.