DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and CG15035

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_572396.1 Gene:CG15035 / 31673 FlyBaseID:FBgn0029949 Length:374 Species:Drosophila melanogaster


Alignment Length:260 Identity:62/260 - (23%)
Similarity:90/260 - (34%) Gaps:100/260 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TTRFFGVFDGHSGSL-SATYATSQLPQLLA-------DQLK-----------------ANP---- 227
            ||..||.|||....| .......|||:|::       |.::                 ::|    
  Fly    82 TTLGFGNFDGEGDYLRQKNKINIQLPRLVSVTCGFAKDHIRYPEYNRGKFGEDAWFMSSSPQACI 146

  Fly   228 ---------------DPAAFS-------------PDFYRN----AFESAFLLADERFTQKKITSG 260
                           ||..||             |||..|    ..|.|:.   :...||....|
  Fly   147 MGVADGVGGWRNYGVDPGKFSMTLMRSCERMSHAPDFKPNRPEILLERAYF---DLLDQKCPIVG 208

  Fly   261 TTSVCALITK---DQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQ-G 321
            :.:.|.|..|   ..||.|.:|||..|:|                        .:|..|..:| .
  Fly   209 SCTACILALKRDDSTLYAANIGDSGFLVV------------------------RSGKVVCRSQEQ 249

  Fly   322 QWRVNGILNVARSIGDYSLEAVIAEPDFVD-----VQLNEAHDFLVLGTDGLWDHVPESLIIETV 381
            |.:.|....:|.....|..:||...|:..|     :||.   |.::|.|||::|:||||.::|.:
  Fly   250 QHQFNTPYQLASPPPGYDFDAVSDGPESADTIQFPMQLG---DVILLATDGVYDNVPESFLVEVL 311

  Fly   382  381
              Fly   312  311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 62/260 (24%)
CG15035NP_572396.1 PP2Cc 133..371 CDD:294085 49/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.