DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1h

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001258008.1 Gene:Ppm1h / 314897 RGDID:1309528 Length:513 Species:Rattus norvegicus


Alignment Length:422 Identity:82/422 - (19%)
Similarity:142/422 - (33%) Gaps:154/422 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DEAAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDK------TTRFFGVFDG 201
            |:|   :||....|:.:.|   :.:.|.:...|...|.. ||..:|.:.      :..::.:|||
  Rat    94 DQA---SCEVLTVKKKVGT---ITSTPNRNSKRRSSLPN-GEGLQLKENSESEGISCHYWSLFDG 151

  Fly   202 HSGSLSATYA--------TSQL--------------PQLLADQLKANP----------------- 227
            |:||.:|..|        |.||              |..|.::.::.|                 
  Rat   152 HAGSGAAVVASRLLQHHITQQLQDIVEILKNSAILPPTCLGEEPESTPAHGRTLTRAASLRGGVG 216

  Fly   228 ---DPAAFSPDFYR-----------NAFESAFLLADERFTQKK----ITSGTTSVCALITKDQLY 274
               .|:.....|:.           .|.||||...|.:..:::    |:.|.|::..:....:||
  Rat   217 APGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSAYNISGGCTALIVVCLLGKLY 281

  Fly   275 IAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQ----------------- 322
            :|..|||:|:::.....:.:.....||.  ||:|::.......|..|.                 
  Rat   282 VANAGDSRAIIIRNGEIIPMSSEFTPET--ERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELG 344

  Fly   323 ------------W----------------------RVNGILNVARSIGDYSLEA----------V 343
                        |                      ||...:.|.|.:||:.|:.          :
  Rat   345 KKMLYRDFNMTGWAYKTIEDDDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFL 409

  Fly   344 IAEPDFVDVQLNE----AHDFLVLGTDGLWDHVPESLIIETVYDSLADT--------TMKLDDIP 396
            .:.|:.....|::    |.|.|:|.||||||.:....:.|.:...|.:.        |:...|:.
  Rat   410 SSAPEVRVYDLSKYEHGADDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLV 474

  Fly   397 KLLIEAAKER---------DSQDNITAVVVLL 419
            .......|:|         .|.|:|:..|:.|
  Rat   475 MRARGVLKDRGWRISNDRLGSGDDISVYVIPL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 76/403 (19%)
Ppm1hNP_001258008.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..133 5/23 (22%)
PP2Cc 142..506 CDD:238083 69/365 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.