DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pp2C1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster


Alignment Length:309 Identity:85/309 - (27%)
Similarity:127/309 - (41%) Gaps:78/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DRFGEMYELLDKTTR----FFGVFDGHSGSLSATYATSQL-------PQLLADQLKANPDPAAFS 233
            |:|...|:....|..    |||::|||.|..:|.:|...|       .|..:||          .
  Fly   272 DQFSVAYQESPITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSDQ----------D 326

  Fly   234 PDFYRNAFES------AFLLADERFTQKK----ITSGTTSVCALITKDQLYIAWVGDSKALL--- 285
            .|..|...|.      |.....|::.:..    .|:|||:..|.:.::::||..||||..:|   
  Fly   327 EDVLRAIREGYIATHFAMWREQEKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDSGIVLGYQ 391

  Fly   286 -VGKRT--QLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRV----------NG---------- 327
             .|:|.  ...|...||||:..|:.||:.:||.|....|..||          .|          
  Fly   392 NKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPMHRGPIRRRTLVDE 456

  Fly   328 --ILNVARSIGD-------YSLEAVIAEPDFVDVQLN-EAHDFLVLGTDGLWDHVPESLIIETV- 381
              .|.||||:||       :....|..:||...|::| .....|:.||||||:.|.....:::| 
  Fly   457 IPFLAVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVR 521

  Fly   382 YDSLADTTMKLDDI---PKLLIE------AAKERDSQDNITAVVVLLKP 421
            .:.|....:...|:   .|.|::      |||:..: ||.:.|.|:|.|
  Fly   522 KEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRA-DNTSVVTVILTP 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 83/305 (27%)
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 83/305 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445096
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.