DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1ba

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_571473.1 Gene:ppm1ba / 30672 ZFINID:ZDB-GENE-991102-16 Length:390 Species:Danio rerio


Alignment Length:298 Identity:88/298 - (29%)
Similarity:142/298 - (47%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219
            :.|..||:|.  ..|..::|                  ..||||:|||:||..|.|.:..|.:.:
Zfish    35 EMEDAHTAAV--GLPHGLDD------------------WSFFGVYDGHAGSRVANYCSKHLLEHI 79

  Fly   220 -----ADQLKANPDPAAFSP--DFYRNAFESAFLLADER---FTQKK---ITSGTTSVCALITKD 271
                 ||:|:....||..:|  :..:....:.||..||.   ||..:   ..||:|:|..|::.:
Zfish    80 VAAGSADELRKAGAPAPETPAIEAVKRGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPE 144

  Fly   272 QLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIG 336
            .||....|||:|||............|||.:|.|::||:.|||:|:..    ||||.|.|:|::|
Zfish   145 HLYFINCGDSRALLCRSGHVCFSTMDHKPCDPREKERIQNAGGSVMIQ----RVNGSLAVSRALG 205

  Fly   337 DYSL----------EAVIAEPDFVDVQLNEAHD-FLVLGTDGLWDHVPESLIIETVYDSLADTTM 390
            ||..          :.|..||:..::..::|.| |:||..||:||.:....:...|...|..|  
Zfish   206 DYDYKCVEGKGPTEQLVSPEPEVFEIARSDAEDEFVVLACDGIWDVMTNEDLCAFVRSRLEVT-- 268

  Fly   391 KLDDIPKL---LIEAAKERDSQDNITAVVVLLKPRHQI 425
              ||:.::   :::.:..:.|:||::.|:|.|....|:
Zfish   269 --DDLERVCNEVVDTSLHKGSRDNMSIVLVCLPNAPQV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 85/285 (30%)
ppm1baNP_571473.1 PP2Cc 23..298 CDD:238083 86/290 (30%)
PP2C_C 292..367 CDD:285117 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.