DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pptc7

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:191 Identity:45/191 - (23%)
Similarity:72/191 - (37%) Gaps:49/191 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 DPAAFSPDFYRNAFESAFLLADERFT-QKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQ 291
            ||:.||....|....   |:.:.||. ...:...|||.|.|:           .:|..|:|..|.
  Rat    92 DPSQFSGTLMRTCER---LVKEGRFVPSNPVGILTTSYCELL-----------QNKVPLLGSSTA 142

  Fly   292 LQLVKPHKPENPDERKRIETA-----------GGTVLHAQGQWRVNGILNVARSIGDYSLEAVI- 344
            ..:|......      |:.||           ||.|:|...:.:.........||.....|.|: 
  Rat   143 CIVVLDRSSH------RLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVL 201

  Fly   345 ------AEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV-------YDSLADTTMKL 392
                  |:....||||.   |.::..||||:|::|:.:|::.:       |:|:..|...:
  Rat   202 SDSPDAADSTSFDVQLG---DIILTATDGLFDNMPDYMILQELKKLKNSNYESIQRTARSI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 45/191 (24%)
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 45/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.