DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1j

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_008759602.1 Gene:Ppm1j / 295341 RGDID:1359104 Length:522 Species:Rattus norvegicus


Alignment Length:386 Identity:85/386 - (22%)
Similarity:144/386 - (37%) Gaps:137/386 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KPRKMEDRCVCLDRFGEMYELLDKTTR-----------FFGVFDGHSGSLSATYATSQLPQLLAD 221
            |.|..||:..|...:.|....:...:|           ::|:||||:|..:|..|:..|.:.:.:
  Rat   132 KSRHNEDQACCEVVYVESRRSITGVSREPSHNQGFSFYYWGLFDGHAGGGAAEMASRLLHRHIRE 196

  Fly   222 QLK-------------------------ANP----DPAAFSP-------DFYRNAFESAFLLADE 250
            |||                         ::|    .|.::||       .....|.|:||.|.||
  Rat   197 QLKDLVEILQDPLPPPLCLPSTPGTPGVSSPSQLVSPQSWSPQKEVTHDSLVVGAIENAFQLMDE 261

  Fly   251 RFTQKK----ITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRI-- 309
            :..:::    :..|..::..:....::|:|..|||:|::|.....:.:.:...||.  ||:|:  
  Rat   262 QMARERRGHLVEGGCCALVVVYLLGKMYVANAGDSRAIIVRNGEIIPMSREFTPET--ERQRLQL 324

  Fly   310 ------ETAGGTVLHAQ----------GQ-----------W----------------------RV 325
                  |..|....|.:          ||           |                      ||
  Rat   325 LGFLKPELLGSEFTHLEFPRRVQPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKARV 389

  Fly   326 NGILNVARSIGDYSLEAVIA----EP---DFVDVQLNE-------AHDFLVLGTDGLWDHVPESL 376
            ...:.|.|.:||::|:...:    :|   .|.:|::.:       ..|.||||||||||...:|.
  Rat   390 MATIGVTRGLGDHNLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTNDSE 454

  Fly   377 IIETVYDSLADTTMKLDD-----IPKLLIEAAK--ERD-----------SQDNITAVVVLL 419
            :..|| |.:..|....|.     :.:.|:..|:  .||           |.|:|:..|:.|
  Rat   455 VAATV-DRVLSTYEPNDPSRYTALAQALVLGARGIPRDRGWRLPNNKLGSGDDISVFVIPL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 84/384 (22%)
Ppm1jXP_008759602.1 PP2Cc 123..514 CDD:238083 84/384 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.