DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1d

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001099295.2 Gene:Ppm1d / 287585 RGDID:1305460 Length:598 Species:Rattus norvegicus


Alignment Length:280 Identity:82/280 - (29%)
Similarity:129/280 - (46%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FFGVFDGHSGSLSATYATSQLPQLLADQLK-ANPDPAAFSPDFYRNAFESAFL-----LAD--ER 251
            ||.|.|||.|..:|.:|...|...:..|.. .:.:||...... |..|.:..|     ||:  :.
  Rat    93 FFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAI-RKGFLACHLAMWKKLAEWPKT 156

  Fly   252 FTQKKITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQ--------LQLVKPHKPENPDERKR 308
            .|....|||||:...:|...::|:|.|||| .:::|.:..        :::.:.||||.|.||:|
  Rat   157 MTGLPSTSGTTASVVIIRGMKMYVAHVGDS-GVVLGIQDDPKDDFVRAVEVTQDHKPELPKERER 220

  Fly   309 IETAGGTVLHAQGQWRV---------NG------------ILNVARSIGD------YSLEAVIA- 345
            ||..||:|::..|..||         :|            .|.|||::||      :|.:.|:: 
  Rat   221 IEGLGGSVMNKSGVNRVVWKRPRLTHSGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGKFVVSP 285

  Fly   346 EPDFVDVQLN-EAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTM---KLDDIPKLLIEAAKER 406
            |||.....|: :.|.:::||:||||:.||....|....|......:   :.....|:|:..|..|
  Rat   286 EPDTSVHTLDPQKHKYIILGSDGLWNMVPPQDAISMCQDQEEKKYLMGEQGQSCAKMLVNRALGR 350

  Fly   407 DSQ-----DNITAVVVLLKP 421
            ..|     ||.:|:|:.:.|
  Rat   351 WRQRMLRADNTSAIVICISP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/276 (29%)
Ppm1dNP_001099295.2 PP2C 84..361 CDD:278884 78/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.