DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1g

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_671742.1 Gene:Ppm1g / 259229 RGDID:628676 Length:542 Species:Rattus norvegicus


Alignment Length:504 Identity:111/504 - (22%)
Similarity:190/504 - (37%) Gaps:150/504 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SRSCVTRTANETYKVSGEERHAELVSAIW--KQLETRGCPAQFRIKLLHR--STQQLEQDLCFAK 97
            :.:|:....|||...|..:.|.....|::  |.|     |...:.:..::  ..|:..||...|.
  Rat    42 AHNCIPELDNETAMFSVYDGHGGEEVALYCAKYL-----PDIIKDQKAYKEGKLQKALQDAFLAI 101

  Fly    98 ECEVTVEGPPQYDLLKLQKFVA---SEFEKYILKLTDNSEVDRLKDFADEAA------------- 146
            :.::|.:     :::|....:|   :|.|....|:.|..:||.     :|||             
  Rat   102 DAKLTTD-----EVIKELAQIAGRPTEDEDDKEKVADEDDVDN-----EEAALLHEEATMTIEEL 156

  Fly   147 ----PENCECHQQKEPLHT-----------------------------------SAAVKNKPRKM 172
                .:||    ||.|.||                                   :|.....|...
  Rat   157 LTRYGQNC----QKGPPHTKSGTGIGDEPEPQGLNGEAGPEDPSRETPSQENGPTAKGHTGPSSN 217

  Fly   173 EDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL-----------ADQLKAN 226
            .|......:.||.           |...|.:|. |.:.|:.:||::.           :|:::..
  Rat   218 SDHGTEAGQIGEP-----------GTATGEAGP-SCSSASDKLPRVAKSKFFEDSEDESDEVEEE 270

  Fly   227 PDPA---AFSPDFYRNAFESAFLLADERFTQKK--------------------ITSGTTSVCALI 268
            .|.:   :...|.|.:  |.|....||..|::.                    ..||||:|.|||
  Rat   271 EDDSEECSEDEDGYSS--EEAENEEDEDDTEEAEEDDDEEMMVPGMEGKEEPGSDSGTTAVVALI 333

  Fly   269 TKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVAR 333
            ...||.:|..|||:.::......|.:...||||:..|..||:.|||.|..   ..||||.||::|
  Rat   334 RGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTM---DGRVNGGLNLSR 395

  Fly   334 SIGDY----------SLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADT 388
            :|||:          ..:.:.|.||...:.|.:.|:|:|:..||:|:.:....:::.:...::..
  Rat   396 AIGDHFYKRNKNLPPQEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQR 460

  Fly   389 TMK-----LDDIPKLLIEAAKERDSQ------DNITAVVVLLKPRHQIE 426
            ...     |..|.:.|::.....|:.      ||:|.:::..|||:.:|
  Rat   461 DENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 76/348 (22%)
Ppm1gNP_671742.1 PP2Cc 25..>110 CDD:214625 15/77 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..139 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..325 28/180 (16%)
PP2Cc <321..502 CDD:238083 53/183 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..542 111/504 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.