DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ptc2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_588356.1 Gene:ptc2 / 2539252 PomBaseID:SPCC1223.11 Length:370 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:88/267 - (32%)
Similarity:123/267 - (46%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 MEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDF 236
            |||....|..|.:. ...:..|.||||||||.|...|.|....||    |.:|:.|   :|....
pombe    36 MEDAHCALLNFTDS-NSSNPPTSFFGVFDGHGGDRVAKYCRQHLP----DIIKSQP---SFWKGN 92

  Fly   237 YRNAFESAFLLADERFTQ----KKITSGTTSVCALITKDQ-LYIAWVGDSKALLVGKRTQLQLVK 296
            |..|.:|.||.||....|    ::..||.|:..|||...| :|.|..|||:.:|..|.|...|..
pombe    93 YDEALKSGFLAADNALMQDRDMQEDPSGCTATTALIVDHQVIYCANAGDSRTVLGRKGTAEPLSF 157

  Fly   297 PHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL----------EAVIAEPDFVD 351
            .|||.|..|:.||..|||.:...    ||||.|.::|:|||:..          :.|.|.||.|.
pombe   158 DHKPNNDVEKARITAAGGFIDFG----RVNGSLALSRAIGDFEYKKDSSLPPEKQIVTAFPDVVI 218

  Fly   352 VQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQ------D 410
            ..::...:||:|..||:||......::|.|...:. ....|:.|.:.|::.....:|:      |
pombe   219 HNIDPDDEFLILACDGIWDCKSSQQVVEFVRRGIV-ARQSLEVICENLMDRCIASNSESCGIGCD 282

  Fly   411 NITAVVV 417
            |:|..:|
pombe   283 NMTICIV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 88/267 (33%)
ptc2NP_588356.1 PP2C 22..278 CDD:278884 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13832
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.