DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1b

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001257548.1 Gene:Ppm1b / 24667 RGDID:3374 Length:465 Species:Rattus norvegicus


Alignment Length:284 Identity:81/284 - (28%)
Similarity:134/284 - (47%) Gaps:46/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219
            :.|..||  ||...|..:||                  ..||.|:|||:||..|.|.::.|.:.:
  Rat    35 EMEDAHT--AVVGIPHGLED------------------WSFFAVYDGHAGSRVANYCSTHLLEHI 79

  Fly   220 A---DQLKANPDPAAFSP--DFYRNAFESAFLLADE---RFTQKK---ITSGTTSVCALITKDQL 273
            .   |...|:....|..|  :..:....:.||..||   .|:..:   ..||:|:|..:|:...:
  Rat    80 TTNEDFRAADKSGFALEPSVENVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPTHI 144

  Fly   274 YIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDY 338
            |....|||:|:|..........:.|||.||.|::||:.|||:|:..    ||||.|.|:|::|||
  Rat   145 YFINCGDSRAVLCRNGQVCFSTQDHKPCNPMEKERIQNAGGSVMIQ----RVNGSLAVSRALGDY 205

  Fly   339 SL----------EAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLD 393
            ..          :.|..||:..::...|..:|:||..||:||.:....:.|.| :|..:.:..|:
  Rat   206 DYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFVVLACDGIWDVMSNEELCEFV-NSRLEVSDDLE 269

  Fly   394 DIPKLLIEAAKERDSQDNITAVVV 417
            ::...:::....:.|:||::.|:|
  Rat   270 NVCNWVVDTCLHKGSRDNMSIVLV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 80/279 (29%)
Ppm1bNP_001257548.1 PP2Cc 23..295 CDD:238083 81/284 (29%)
PP2C_C 289..365 CDD:285117 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.