DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1a

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_038967714.1 Gene:Ppm1a / 24666 RGDID:3373 Length:455 Species:Rattus norvegicus


Alignment Length:287 Identity:86/287 - (29%)
Similarity:133/287 - (46%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219
            :.|..||  ||...|..:|                  |..||.|:|||:||..|.|....    |
  Rat   108 EMEDAHT--AVIGLPSGLE------------------TWSFFAVYDGHAGSQVAKYCCEH----L 148

  Fly   220 ADQLKANPD----PAAFSPDFYRNAFESAFLLADER---FTQKK---ITSGTTSVCALITKDQLY 274
            .|.:..|.|    ..|.|.:..:|...:.||..||.   .::||   ..||:|:|..||:....|
  Rat   149 LDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY 213

  Fly   275 IAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYS 339
            ....|||:.||...|......:.|||.||.|::||:.|||:|:..    ||||.|.|:|::||:.
  Rat   214 FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQ----RVNGSLAVSRALGDFD 274

  Fly   340 L----------EAVIAEPDFVDVQLNEAHD-FLVLGTDGLWDHVPESLIIETVYDSLADTTMKLD 393
            .          :.|..||:..|::.:|..| |::|..||:||.:....:.:.|...|..|    |
  Rat   275 YKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVT----D 335

  Fly   394 DIPKL---LIEAAKERDSQDNITAVVV 417
            |:.|:   :::....:.|:||::.:::
  Rat   336 DLEKVCNEVVDTCLYKGSRDNMSVILI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 85/282 (30%)
Ppm1aXP_038967714.1 PP2Cc 96..364 CDD:238083 86/287 (30%)
PP2C_C 358..436 CDD:400262 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.