DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pdp2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_659559.2 Gene:Pdp2 / 246311 RGDID:628812 Length:530 Species:Rattus norvegicus


Alignment Length:402 Identity:77/402 - (19%)
Similarity:127/402 - (31%) Gaps:150/402 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YDLLKLQKFVASEFEKYILKLTDNSEVDRLKDFADEAAPE----NCECHQQKEPLHTSAAVKNKP 169
            :.|.|..:..::|.|.:.|:|:.....|.|:  |.|::.:    |...........::....|.|
  Rat    58 FALRKAYRHTSTEEEDFHLQLSPEQVSDLLR--AGESSHKVLDFNSGVPNSVLRFESNQLAANSP 120

  Fly   170 RKMEDR---CVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQL---------------- 215
              :|||   ..|:...|.|          ||:||||.|...|...:.:|                
  Rat   121 --VEDRQGVASCVQTRGTM----------FGIFDGHGGHACAQAVSERLFYYMAVSLMSHKTLEQ 173

  Fly   216 ---------PQLLADQLKANPDPAAFSP-----------------DFYRN---AFESAFLLADER 251
                     |.|...|...:|..:.:..                 |.:..   :.|.|.:.:.:|
  Rat   174 MEEAMENMKPLLPILQWLKHPGDSIYKDITSVHLDHLRVYWQELLDLHMETGLSTEEALMYSFQR 238

  Fly   252 F-----------TQKKIT---------SGTTSVCALITKDQLYIAWVGDSKALL----------- 285
            .           .:.::|         ||.|:..|.:....|:||..||.:|:|           
  Rat   239 LDSDISLEIQAPLEDEVTKNLSLQVAFSGATACMAHVDGVHLHIANAGDCRAILGVQGDNGAWSC 303

  Fly   286 --------VGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL-- 340
                    .....:|..:|...||:.|....|:.            |:.|:|...|:.||..|  
  Rat   304 LPLTCDHNAWNEAELSRLKREHPESEDRTLIIDD------------RLLGVLLPCRAFGDVQLKW 356

  Fly   341 ---------------EA----------------VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPE 374
                           ||                :.|:|:....:|.....||||.:|||||.:..
  Rat   357 SKELQRNVLERGFDTEALNIYQFTPPHYHTPPYLTAKPEVTYHRLRPQDKFLVLASDGLWDMLDN 421

  Fly   375 SLIIETVYDSLA 386
            ..::..|...|:
  Rat   422 EDVVRLVVGHLS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 66/347 (19%)
Pdp2NP_659559.2 PP2Cc 96..516 CDD:214625 67/362 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338421
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.