DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1n

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_006539883.1 Gene:Ppm1n / 232941 MGIID:2142330 Length:452 Species:Mus musculus


Alignment Length:298 Identity:94/298 - (31%)
Similarity:140/298 - (46%) Gaps:45/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 AAPENCECHQQKEPLHTSAAVKNKPR-----------KMED-RCVCLDRFGEMYELLDKTTRFFG 197
            |||   .|.|:   ||..||..:..|           :||| .|..|...|     |.....||.
Mouse    40 AAP---RCWQR---LHRGAAATSGLRFGASAVQGWRARMEDAHCARLALPG-----LPSGWAFFA 93

  Fly   198 VFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFT---QKKITS 259
            |.|||.|:.:|.:....||..:..:|    .||...||..|.|..||||.||.:.:   .:....
Mouse    94 VLDGHGGARAARFGARHLPGYVLGEL----GPAPQEPDGVRQALRSAFLQADAQLSALWPRGDPG 154

  Fly   260 GTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWR 324
            |:|:|..|::...||:|..|||:|||....:.....:.|:|..|.||:||..|||||...    |
Mouse   155 GSTAVALLVSPRFLYLAHCGDSRALLSRSGSVAFCTEDHRPHRPRERERIHDAGGTVRRR----R 215

  Fly   325 VNGILNVARSIGDYS----------LEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIE 379
            |.|.|.|:|::||::          |:.|.|||:...:...:..:|::|.:||:||.:..:.:..
Mouse   216 VEGSLAVSRALGDFAYKQAPGRPPELQLVSAEPEVAALARQDEDEFVLLASDGVWDALSGADLAG 280

  Fly   380 TVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVV 417
            .|...|. ..:.|:.:...|::....:.|.||:|.:||
Mouse   281 LVTSRLR-LGLDLELLCAQLLDTCLCKGSLDNMTCMVV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 88/283 (31%)
Ppm1nXP_006539883.1 PP2Cc 59..319 CDD:238083 85/273 (31%)
PP2C_C 313..387 CDD:369544 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.