DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1b

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001152968.1 Gene:Ppm1b / 19043 MGIID:101841 Length:477 Species:Mus musculus


Alignment Length:244 Identity:72/244 - (29%)
Similarity:124/244 - (50%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FFGVFDGHSGSLSATYATSQLPQLLA---DQLKANPDPAAFSP--DFYRNAFESAFLLADE---R 251
            ||.|:|||:||..|.|.::.|.:.:.   |...|:...:|..|  :..:....:.||..||   .
Mouse    55 FFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRN 119

  Fly   252 FTQKK---ITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAG 313
            |:..:   ..||:|:|..:::...:|....|||:|:|..........:.|||.||.|::||:.||
Mouse   120 FSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAG 184

  Fly   314 GTVLHAQGQWRVNGILNVARSIGDYSL----------EAVIAEPDFVDVQLNEAHDFLVLGTDGL 368
            |:|:..    ||||.|.|:|::|||..          :.|..||:..::...|..:|:||..||:
Mouse   185 GSVMIQ----RVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGI 245

  Fly   369 WDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITAVVV 417
            ||.:....:.|.|...| :.:..|:::...:::....:.|:||::.|:|
Mouse   246 WDVMSNEELCEFVKSRL-EVSDDLENVCNWVVDTCLHKGSRDNMSVVLV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 72/244 (30%)
Ppm1bNP_001152968.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PP2Cc 23..295 CDD:238083 72/244 (30%)
PP2C_C 289..365 CDD:369544 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.