DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Ppm1a

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_036013148.1 Gene:Ppm1a / 19042 MGIID:99878 Length:454 Species:Mus musculus


Alignment Length:287 Identity:86/287 - (29%)
Similarity:133/287 - (46%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219
            :.|..||  ||...|..:|                  |..||.|:|||:||..|.|....    |
Mouse   107 EMEDAHT--AVIGLPSGLE------------------TWSFFAVYDGHAGSQVAKYCCEH----L 147

  Fly   220 ADQLKANPD----PAAFSPDFYRNAFESAFLLADER---FTQKK---ITSGTTSVCALITKDQLY 274
            .|.:..|.|    ..|.|.:..:|...:.||..||.   .::||   ..||:|:|..||:....|
Mouse   148 LDHITNNQDFRGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY 212

  Fly   275 IAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYS 339
            ....|||:.||...|......:.|||.||.|::||:.|||:|:..    ||||.|.|:|::||:.
Mouse   213 FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQ----RVNGSLAVSRALGDFD 273

  Fly   340 L----------EAVIAEPDFVDVQLNEAHD-FLVLGTDGLWDHVPESLIIETVYDSLADTTMKLD 393
            .          :.|..||:..|::.:|..| |::|..||:||.:....:.:.|...|..|    |
Mouse   274 YKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVT----D 334

  Fly   394 DIPKL---LIEAAKERDSQDNITAVVV 417
            |:.|:   :::....:.|:||::.:::
Mouse   335 DLEKVCNEVVDTCLYKGSRDNMSVILI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 85/282 (30%)
Ppm1aXP_036013148.1 PP2Cc 95..363 CDD:238083 86/287 (30%)
PP2C_C 357..435 CDD:400262 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.