DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm-1.D

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_497539.3 Gene:ppm-1.D / 190269 WormBaseID:WBGene00021856 Length:766 Species:Caenorhabditis elegans


Alignment Length:339 Identity:90/339 - (26%)
Similarity:132/339 - (38%) Gaps:83/339 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QQKEPLH------------TSAAVKNKPRKMEDRCVC-LDRFGEMYELLDKTTRFFGVFDGHSGS 205
            |..||:.            |.||.:...|.||||||. .:|...  .|||.|  |.||||||.|.
 Worm     3 QTSEPMARTPIQFGENMRITVAASQGGRRYMEDRCVIHTERINN--GLLDWT--FVGVFDGHGGE 63

  Fly   206 LSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADER---------FTQK--KITS 259
            .::.|....|...:....|...:    |.:....|....||:..|:         :|..  ..|:
 Worm    64 HASEYVRRHLLMNITKNQKFESN----SDEDILEAIRQGFLMTHEQMRHVYDEWPYTASGYPSTA 124

  Fly   260 GTTSVCALITKDQLYIAWVGDSKALL----VGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQ 320
            |||..|..|...:||...||||...|    .|:.....|...||||:..|:.||..|||......
 Worm   125 GTTVSCVFIRNGKLYTGHVGDSAIFLGTVENGELHSRPLTTDHKPESVHEQLRIAKAGGETAVKS 189

  Fly   321 GQWRV----------------NG----------------ILNVARSIGDY-------SLEAVIAE 346
            |..||                |.                .|:||||:||.       ::..|..|
 Worm   190 GVTRVVWKRPQKMSQFMMMTSNSNEQKHHQNPQIMENIPFLSVARSLGDLWSYNEKTNMFIVSPE 254

  Fly   347 PDFVDVQLNEAHDF-LVLGTDGLWDHVPESLIIETVY--DSLADTTMKLD-DIPKLLIEAAKERD 407
            || :.|.....:|| |||.:||:.:.:.....|..|:  :.:.:...::: :..:.::.:|.::.
 Worm   255 PD-LGVHRLTGNDFCLVLASDGMTNVMTGDQAISIVFKEEEMVEIHEEINRNHSRCVLRSALQKW 318

  Fly   408 SQ---DNITAVVVL 418
            ..   ||:|...|:
 Worm   319 RSLRADNVTIATVI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 87/333 (26%)
ppm-1.DNP_497539.3 PP2Cc 19..333 CDD:238083 87/323 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.