DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and W09D10.4

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_499362.1 Gene:W09D10.4 / 176497 WormBaseID:WBGene00012362 Length:330 Species:Caenorhabditis elegans


Alignment Length:292 Identity:70/292 - (23%)
Similarity:114/292 - (39%) Gaps:83/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NKPRKMEDRCVCLDRFGEMYELLD--KTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDP 229
            |.|..:.|:.|    ||:....:.  |.|...||.||..|........|...:.|..:.:.....
 Worm    82 NGPSTVLDKGV----FGDDAWFISRFKNTFVVGVADGVGGWRKYGIDPSAFSRRLMKECEKRVQK 142

  Fly   230 AAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCALIT-KDQLYIAWVGDSKALLV--GK--- 288
            ..|.|....:..:.||..:.|  ..:.:  |:::.|.|:. :::||.|.:|||..::|  ||   
 Worm   143 GDFDPQKPESLLDYAFRASAE--APRPV--GSSTACVLVVHQEKLYSANLGDSGFMVVRNGKIVS 203

  Fly   289 --RTQL-------QLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVI 344
              |.|:       ||..|  ||.                .||            .|||   :|.:
 Worm   204 KSREQVHYFNAPFQLTLP--PEG----------------YQG------------FIGD---KADM 235

  Fly   345 AEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLI-------------IETVYDSLADTTMKLD-DI 395
            |:.|.:.|:..   |.::|.|||:||::.|..:             ::.|.::||.|..:|. |.
 Worm   236 ADKDEMAVKKG---DIILLATDGVWDNLSEQQVLDQLKALDAGKSNVQEVCNALALTARRLAFDS 297

  Fly   396 PKLLIEAAKERD--------SQDNITAVVVLL 419
            ......|.|.|:        ..|:||.|::|:
 Worm   298 KHNSPFAMKAREHGFLAPGGKPDDITLVLLLI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 69/290 (24%)
W09D10.4NP_499362.1 PP2Cc 72..327 CDD:214625 69/288 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.