DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and pdp-1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_491357.1 Gene:pdp-1 / 172035 WormBaseID:WBGene00022832 Length:451 Species:Caenorhabditis elegans


Alignment Length:381 Identity:87/381 - (22%)
Similarity:136/381 - (35%) Gaps:119/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LQKFVASEFEKYILKLTDNSEVDRLKDFADEAAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVC 178
            |::.|.:||.::                 :.::..|.:.|.:..  ..||.|::......|.|..
 Worm     2 LKRKVITEFRRH-----------------NRSSRWNADAHLRAH--ERSANVEDDAIMRVDTCQL 47

  Fly   179 -----LDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQL-PQLLADQLK------------- 224
                 ::.|....:.|......|||||||.|...:.:.::.| |.|.|..||             
 Worm    48 AANNPIEDFYSAAKCLSSRAFLFGVFDGHGGQQCSRHISTNLYPYLCASVLKKHEVVDYPSDQRL 112

  Fly   225 ----ANPD---PAAF-----------------SPDFY----RNAFESAFLLADERFTQKKI---- 257
                ::.|   |.||                 :.:.|    |.|.:.||...|:...:..:    
 Worm   113 EWLFSSSDGHLPNAFKGRETQHIAEYHKQFKKNANAYTGTVREALKLAFETCDKDLAENALPSAK 177

  Fly   258 -----------TSGTTSVCALITKDQLYIAWVGDSKALL-----VGKRTQLQLVKPHKPENPDER 306
                       .||:....|.|....|::|.:||:.|:|     .|..|..||.:.|..:|.||.
 Worm   178 GVIDRHAAMVAASGSCCTLAHIRSRHLHVANLGDAAAVLGVVNPNGSVTARQLSRAHCVDNADEV 242

  Fly   307 KRIETA-----GGTVLHAQGQWRVNGILNVARSIGD------YSLEAVIAEP--------DFVDV 352
            .||..|     ..|||..   .|:.|.|...|:.||      ..|:.|:.||        .|...
 Worm   243 HRIRIAHPASESQTVLRG---GRLLGELFPLRAFGDVRYKWPLDLQKVVLEPLGHPPPQHLFTPP 304

  Fly   353 QLNEAHD-----------FLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPK 397
            .|:.:.:           ||||.|||||:.:....::..|:|....|..:...:||
 Worm   305 YLSTSPEVFYHKLTPNDRFLVLATDGLWEWLDPDTVVRLVHDHTLGTITQQPYVPK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 81/335 (24%)
pdp-1NP_491357.1 PP2Cc 43..438 CDD:238083 78/321 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.