DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPTC7

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_644812.1 Gene:PPTC7 / 160760 HGNCID:30695 Length:304 Species:Homo sapiens


Alignment Length:199 Identity:46/199 - (23%)
Similarity:72/199 - (36%) Gaps:65/199 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 DPAAFSPDFYRNAFESAFLLADERFT-QKKITSGTTSVCALI-------------------TKDQ 272
            ||:.||....|....   |:.:.||. ...|...|||.|.|:                   |..:
Human    89 DPSQFSGTLMRTCER---LVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHR 150

  Fly   273 LYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD 337
            |:.|.:|||..|:|                         .||.|:|...:.:.........||..
Human   151 LHTANLGDSGFLVV-------------------------RGGEVVHRSDEQQHYFNTPFQLSIAP 190

  Fly   338 YSLEAVI-------AEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV-------YDSLADT 388
            ...|.|:       |:....||||.   |.::..||||:|::|:.:|::.:       |:|:..|
Human   191 PEAEGVVLSDSPDAADSTSFDVQLG---DIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQT 252

  Fly   389 TMKL 392
            ...:
Human   253 ARSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 46/199 (23%)
PPTC7NP_644812.1 PP2Cc 60..296 CDD:412173 46/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.