Sequence 1: | NP_609899.1 | Gene: | CG10376 / 35126 | FlyBaseID: | FBgn0032702 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_644812.1 | Gene: | PPTC7 / 160760 | HGNCID: | 30695 | Length: | 304 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 46/199 - (23%) |
---|---|---|---|
Similarity: | 72/199 - (36%) | Gaps: | 65/199 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 228 DPAAFSPDFYRNAFESAFLLADERFT-QKKITSGTTSVCALI-------------------TKDQ 272
Fly 273 LYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD 337
Fly 338 YSLEAVI-------AEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETV-------YDSLADT 388
Fly 389 TMKL 392 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10376 | NP_609899.1 | PP2Cc | 160..419 | CDD:238083 | 46/199 (23%) |
PPTC7 | NP_644812.1 | PP2Cc | 60..296 | CDD:412173 | 46/199 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |