DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPM1K

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_689755.3 Gene:PPM1K / 152926 HGNCID:25415 Length:372 Species:Homo sapiens


Alignment Length:287 Identity:92/287 - (32%)
Similarity:139/287 - (48%) Gaps:52/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 ENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYAT 212
            ||..|          |:...|.::.|||.       :..:|.|:.. :|.|:|||.|..:|.:..
Human    93 ENVGC----------ASQIGKRKENEDRF-------DFAQLTDEVL-YFAVYDGHGGPAAADFCH 139

  Fly   213 SQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQKK--------ITSGTTSVCALIT 269
            :.:.:.:.|.|....:        .......|||..|:.|:...        :|||||:..||: 
Human   140 THMEKCIMDLLPKEKN--------LETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALL- 195

  Fly   270 KD--QLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVL-HAQGQWRVNGILNV 331
            :|  :|.:|.||||:|:|..|...::|...|.||..||::||:..||.|. ::.||..|||.|.:
Human   196 RDGIELVVASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAM 260

  Fly   332 ARSIGDYSLE--AVIAEPDFVDVQLNEAHD-FLVLGTDGLWDHVPESLIIETV---YDSLADTTM 390
            .|||||..|:  .|||||:...::|:.|.| ||||.|||:...|....|.:.|   :|.      
Human   261 TRSIGDLDLKTSGVIAEPETKRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDP------ 319

  Fly   391 KLDDIPKLLIEAAKERDSQDNITAVVV 417
              ::....:.|.|.:..::||.|||||
Human   320 --NEAAHAVTEQAIQYGTEDNSTAVVV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 89/275 (32%)
PPM1KNP_689755.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..55
PP2Cc 95..346 CDD:238083 90/285 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144722
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.