DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPM1L

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_640338.2 Gene:PPM1L / 151742 HGNCID:16381 Length:360 Species:Homo sapiens


Alignment Length:261 Identity:89/261 - (34%)
Similarity:129/261 - (49%) Gaps:23/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 DRFGEMYELLDKT-TRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFES 243
            |||..:.:|.:|| ...||:||||.|..:|.|..|:||:.|...|:........|...|:...|.
Human   107 DRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQ 171

  Fly   244 AFLLADERFTQKKITS----GTTSVCALITKDQLYIAWVGDSKALLVGK-RTQLQLVKPHKPENP 303
            ..|..|....:|...|    |||.:.||::...|.:|.||||:.:|..| ...:.|...|||...
Human   172 QILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQL 236

  Fly   304 DERKRIETAGGTVLHAQGQWRVNGILNVARSIGDY---SLEAVIAEPDFVDVQLNEAH-DFLVLG 364
            .|||||:.||| .:...|.|||.|||.::||:|||   :|..||.:||.:...|::.. :|::|.
Human   237 KERKRIKRAGG-FISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILA 300

  Fly   365 TDGLWDHVPESLIIETVYDSLADTTMKLDDIP----KLLIEAAKERDSQDNITAVVVLLKPRHQI 425
            :|||||.......:..:.:.|        |.|    |.::..:..|...||||.:||..:...:.
Human   301 SDGLWDAFSNEEAVRFIKERL--------DEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKT 357

  Fly   426 E 426
            |
Human   358 E 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 88/252 (35%)
PPM1LNP_640338.2 PP2Cc 93..351 CDD:238083 88/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.