DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PP2D1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001239586.1 Gene:PP2D1 / 151649 HGNCID:28406 Length:630 Species:Homo sapiens


Alignment Length:476 Identity:97/476 - (20%)
Similarity:163/476 - (34%) Gaps:152/476 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPASECAHLMEFKRFLVSTAEKAAAVSEEVVSRSCVTRTANETYKVSGEERHAELVSAIWKQLET 70
            :|.|.|.|.::.....:...:..|              .|...::..|.::....|.|:.:    
Human    64 LPCSICKHEIDLTGIFLHKKQHVA--------------LATLGFQWMGRKKPQPSVIAVQR---- 110

  Fly    71 RGCPAQFRIKLLHRS---TQQLEQDLCFAKECEVTVEGPPQYDLLKLQKFVASEFEKYILKLTDN 132
                 ||.|..|..|   |::..|.:..|.|.....:.|..|                  |:.||
Human   111 -----QFMISKLLSSFMFTEKTLQSINNAFELLWKKQIPAYY------------------KIFDN 152

  Fly   133 SEVDRLKDFADEAAPENCECHQQKEPLHTSAAV---KNKPRK--MEDRCVCLDRFGEMYELLDKT 192
              :||...::.:.      ||.    |.....:   :|...|  |.|:...:..||....:.   
Human   153 --IDRSVIYSQKI------CHL----LIKGVGICEDRNSTWKADMNDKFTVVSNFGNKPNVC--- 202

  Fly   193 TRFFGVFDGHSGSLSATYATSQLPQLLADQL-KANP------DPAAFSPDFY------------- 237
              |||:||||.|:.:|...:.:||.||..|| |.:|      |.......||             
Human   203 --FFGLFDGHHGASAAELTSMELPVLLLHQLSKFDPSYQMTTDEQQIINSFYTVFREEYAAIEDL 265

  Fly   238 -----------------RNAFESAFLLADE--RFTQKKIT----SGTTSV-CALITKDQ------ 272
                             ..||..||...|.  ...:|:::    ||.::| |.|..|.:      
Human   266 FSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGCSAVTCILEGKPKSPYAHK 330

  Fly   273 ---------------------------LYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIE 310
                                       |::|..|:.:|:|........|.|.|...|.:||:||.
Human   331 NWKRKNTHDGLAESSPSQEMPKIISGILHVANTGNVQAVLCRNGKGFCLTKEHTTRNTNERRRIL 395

  Fly   311 TAGGTVLHAQGQWRVNGILNVARSIGDYS----LEAVIAEPDFVDVQLNEAHDFLVLGTDGLWDH 371
            ..|..:...:....|.|.:...|.:|.:.    .:::|..|..:.|.:::...||::.|:|||:.
Human   396 QNGAVISSNEPYGLVEGQVKTTRGLGFHGNLKLKKSIIPAPQTISVPIDDLCQFLIVATNGLWEV 460

  Fly   372 VPESLIIETVYDSLADTTMKL 392
            :.:..:     .:||.||..:
Human   461 LDKEEV-----TALAMTTFHM 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 69/319 (22%)
PP2D1NP_001239586.1 PP2Cc 181..466 CDD:238083 64/289 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 557..578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.