DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPM1N

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001073870.1 Gene:PPM1N / 147699 HGNCID:26845 Length:430 Species:Homo sapiens


Alignment Length:274 Identity:84/274 - (30%)
Similarity:132/274 - (48%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SAAVKNKPRKMED-RCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKA 225
            ::|.:....:||| .|..|...|     |......|.|.|||.|:.:|.:....||..:..:|  
Human    69 ASAAQGWRARMEDAHCTWLSLPG-----LPPGWALFAVLDGHGGARAARFGARHLPGHVLQEL-- 126

  Fly   226 NPDPAAFSPDFYRNAFESAFLLADERFTQ---KKITSGTTSVCALITKDQLYIAWVGDSKALLVG 287
            .|:|:  .|:..|.|...|||.||||...   :..|.|.|:|..|::...||:|..|||:|:|..
Human   127 GPEPS--EPEGVREALRRAFLSADERLRSLWPRVETGGCTAVVLLVSPRFLYLAHCGDSRAVLSR 189

  Fly   288 KRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYS----------LEA 342
            ........:.|:|..|.||:||..||||:...    ||.|.|.|:|::||::          |:.
Human   190 AGAVAFSTEDHRPLRPRERERIHAAGGTIRRR----RVEGSLAVSRALGDFTYKEAPGRPPELQL 250

  Fly   343 VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKL----LIEAA 403
            |.|||:...:......:|::|.:||:||.|..:.:.     .|..:.::|...|:|    |::..
Human   251 VSAEPEVAALARQAEDEFMLLASDGVWDTVSGAALA-----GLVASRLRLGLAPELLCAQLLDTC 310

  Fly   404 KERDSQDNITAVVV 417
            ..:.|.||:|.::|
Human   311 LCKGSLDNMTCILV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 84/274 (31%)
PPM1NNP_001073870.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..65
PP2Cc 66..326 CDD:238083 84/274 (31%)
PP2C_C 320..394 CDD:285117 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.