DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AgaP_AGAP008149

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_317314.3 Gene:AgaP_AGAP008149 / 1277813 VectorBaseID:AGAP008149 Length:371 Species:Anopheles gambiae


Alignment Length:263 Identity:79/263 - (30%)
Similarity:125/263 - (47%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RCVCLDRFGEMYELLDKTT--RFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFY 237
            ||...|.:.....|.|...  .:|.|||||:|...|.:..:.|.|.:....:       |..:..
Mosquito    36 RCEMEDAYHAKTGLGDSLDDWNYFAVFDGHAGDNVAKHCAANLLQRIITTTE-------FGNNDI 93

  Fly   238 RNAFESAFLLADERFTQKKI--------TSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQL 294
            .....:.||..||  :.:.|        .||||:|||.|:...||||..|||:|:|......:..
Mosquito    94 TKGIHTGFLQLDE--SMRAIPELASGLDKSGTTAVCAFISGQHLYIANCGDSRAVLCQNAQPIFT 156

  Fly   295 VKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL----------EAVIAEPDF 349
            .:.|||..|.|::||:.|||:|:    ..||||.|.|:|::|||..          :.|..||:.
Mosquito   157 TQDHKPILPGEKERIQNAGGSVM----VQRVNGSLAVSRALGDYDYKKVANLGQCEQLVSPEPEI 217

  Fly   350 VDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQDNITA 414
            .......|.:||||..||:||.:....:.:.|::.| :.:..|.|:...:|:....:.|:||::.
Mosquito   218 FCRDREPADEFLVLACDGVWDVMSNEELCQFVHNRL-EVSDNLVDVANQVIDTCLHKGSRDNMSI 281

  Fly   415 VVV 417
            :::
Mosquito   282 III 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 79/263 (30%)
AgaP_AGAP008149XP_317314.3 PP2Cc 26..286 CDD:238083 79/263 (30%)
PP2C_C 280..353 CDD:285117 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.